PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00291.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 296aa    MW: 34452.9 Da    PI: 8.4792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00291.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.6e-1772117147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+++G+ +W++Ia++++ gR++k+c++rw++ 
  Rsa1.0_00291.1_g00010.1  72 RGHWRPAEDAKLKELVALYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 117
                              899*****************************.***********996 PP

2Myb_DNA-binding55.11.8e-17124167146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r  +++eE+e l +a++++G++ W+ Iar ++ gRt++++k++w+ 
  Rsa1.0_00291.1_g00010.1 124 RRTFSEEEEEMLMQAHNLYGNK-WAMIARLFP-GRTDNSVKNHWHV 167
                              6689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.60367118IPR017930Myb domain
SuperFamilySSF466893.75E-2971165IPR009057Homeodomain-like
SMARTSM007171.8E-1471120IPR001005SANT/Myb domain
PfamPF002491.4E-1672117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2673125IPR009057Homeodomain-like
CDDcd001677.49E-1375116No hitNo description
PROSITE profilePS5129425.344119173IPR017930Myb domain
SMARTSM007175.0E-15123171IPR001005SANT/Myb domain
PfamPF002491.1E-14124166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-21126172IPR009057Homeodomain-like
CDDcd001671.81E-11126166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSEDHRRWMD QIASCDYFSF DFSSYQHSGH YYASHREEEI KNPNQSNNGN CSKKETRVCG  60
NFRHSSKASA ARGHWRPAED AKLKELVALY GPQNWNLIAE KLQGRSGKSC RLRWFNQLDP  120
RINRRTFSEE EEEMLMQAHN LYGNKWAMIA RLFPGRTDNS VKNHWHVIMA RKFREQSSVY  180
RRRKTLIPLK PLVNPSPLSC NGFDPTRSDM IHLVSNDQNH LMLPIPCFPG YAHENESPLM  240
LGMLQNQMMV DDYSARTREA TTFDFLNQTE KCEMLGDGMN EQKKPHFIDF LGLGTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-33711736108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013694796.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A078JK270.0A0A078JK27_BRANA; BnaC06g43380D protein
STRINGBra003995.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-154myb domain protein 105